Protein Info for DVU1349 in Desulfovibrio vulgaris Hildenborough JW710

Name: SelGGPS
Annotation: geranylgeranyl diphosphate synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF00348: polyprenyl_synt" amino acids 21 to 252 (232 residues), 206.4 bits, see alignment E=2.2e-65

Best Hits

KEGG orthology group: K13789, geranylgeranyl diphosphate synthase, type II [EC: 2.5.1.1 2.5.1.10 2.5.1.29] (inferred from 100% identity to dvu:DVU1349)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.1 or 2.5.1.10 or 2.5.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CD4 at UniProt or InterPro

Protein Sequence (287 amino acids)

>DVU1349 geranylgeranyl diphosphate synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQAARVEGYLATCLAGRGIPPRLQSAMEYSLLAGGKRLRPVLCLSTAGMTGLDPMSVMPF
AAAIELIHTYSLIHDDLPAMDDDDLRRGRPSNHRQFDEATAILAGDGLLTDAFDLMASVG
GGIPAGHVLAALREVSSAAGSSGMVGGQALDMDYTGRDDIDLAALRTMHAMKTGALIRCS
CVAGALLGGAPASAVEQVAGYGAAIGAAFQIVDDILDETGDEAQLGKPVGSDVEQGKVTY
PSLLGIERSRALAQEQADIAVTCLADFEGEDADFLRALAQYIVDRVS