Protein Info for DVU1348 in Desulfovibrio vulgaris Hildenborough JW710

Name: xseB
Annotation: exodeoxyribonuclease VII, small subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 81 TIGR01280: exodeoxyribonuclease VII, small subunit" amino acids 9 to 60 (52 residues), 63.1 bits, see alignment E=9.9e-22 PF02609: Exonuc_VII_S" amino acids 10 to 60 (51 residues), 61.1 bits, see alignment E=4.1e-21

Best Hits

Swiss-Prot: 100% identical to EX7S_DESVH: Exodeoxyribonuclease 7 small subunit (xseB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 100% identity to dvu:DVU1348)

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CD5 at UniProt or InterPro

Protein Sequence (81 amino acids)

>DVU1348 exodeoxyribonuclease VII, small subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAGRKKAADFEQQLARLQEIVDALEGGDLPLEKSVALYKEGLGLARASREQLAKARNEIR
LFTEGEVRDFDPEEGDDGDDR