Protein Info for DVU1341 in Desulfovibrio vulgaris Hildenborough JW710

Name: znuC
Annotation: permease component of zinc ABC transporter (Dmitry Rodionov)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 174 to 203 (30 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details PF00950: ABC-3" amino acids 7 to 256 (250 residues), 204.3 bits, see alignment E=1.3e-64

Best Hits

Swiss-Prot: 45% identical to Y2045_SYNY3: Uncharacterized membrane protein slr2045 (slr2045) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 100% identity to dvl:Dvul_1727)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CE2 at UniProt or InterPro

Protein Sequence (274 amino acids)

>DVU1341 permease component of zinc ABC transporter (Dmitry Rodionov) (Desulfovibrio vulgaris Hildenborough JW710)
MFDALAYDFVRNACAAAVLASIACGIIGTLVVVNRIVFLAGGVAHAAYGGIGIAVHWGLP
MLPCTVGFSLAASLGMAHIAYRHAEKADAAIGLLWAAGMAFGIILLDLTPGYRADLMSFL
FGSILAVPEGDLLLMLVVDVGLLLIVGLCHQTLLVASFDPEFAEARGLPVKATFLLVVGM
TALGVVLLIRIVGLVLVMALLTIPPFIAQRRARSLPRMMLAATLWSLVFCLSGLWLAYRF
DLTSGAAIIAAAVVGFSLMMGRDMLLERFGKETP