Protein Info for DVU1320 in Desulfovibrio vulgaris Hildenborough JW710
Name: rpsE
Annotation: ribosomal protein S5 (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RS5_DESVV: 30S ribosomal protein S5 (rpsE) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)
KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 100% identity to dvl:Dvul_1748)MetaCyc: 55% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q72CG3 at UniProt or InterPro
Protein Sequence (163 amino acids)
>DVU1320 ribosomal protein S5 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MEQNEFGLIEKIVYLNRVAKVVKGGRRFSFSALVVVGDGKGSVGFGLGKAQEVPEALRKA TERAKKSMIEVPLIDGTLPYEILGRFGAGHVLLKPASKGTGIIAGGAVRAVMEAVGVTDV LTKAIGTNNPHNVLRATVAGLASLRSAEEVGQLRGKKLEAPRK