Protein Info for DVU1316 in Desulfovibrio vulgaris Hildenborough JW710

Name: rpsN
Annotation: ribosomal protein S14 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 PF00253: Ribosomal_S14" amino acids 9 to 60 (52 residues), 91.8 bits, see alignment E=8.5e-31

Best Hits

Swiss-Prot: 100% identical to RS14Z_DESVH: 30S ribosomal protein S14 type Z (rpsZ) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02954, small subunit ribosomal protein S14 (inferred from 97% identity to dvm:DvMF_0092)

Predicted SEED Role

"SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-dependent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CG7 at UniProt or InterPro

Protein Sequence (61 amino acids)

>DVU1316 ribosomal protein S14 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRTSLEVKAQRKPKFSARAYNRCPICGRPRAYLRKFGLCRICFRNMALRGELPGVRKSS
W