Protein Info for DVU1295 in Desulfovibrio vulgaris Hildenborough JW710

Name: sat
Annotation: sulfate adenylyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14306: PUA_2
  • amino acids 7 to 176 (170 residues), 176.7 bits, E=2.7e-56
• TIGR00339: sulfate adenylyltransferase
  • amino acids 8 to 405 (398 residues), 352.3 bits, E=1.4e-109
• PF01747: ATP-sulfurylase
  • amino acids 187 to 406 (220 residues), 270.6 bits, E=8.2e-85

Best Hits

Swiss-Prot: 83% identical to SAT_DESDA: Sulfate adenylyltransferase (sat) from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)

KEGG orthology group: K00958, sulfate adenylyltransferase [EC: 2.7.7.4] (inferred from 100% identity to dvl:Dvul_1771)

Predicted SEED Role

No annotation

MetaCyc Pathways

• dissimilatory sulfate reduction I (to hydrogen sufide)) (5/5 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (9/12 steps found)
• assimilatory sulfate reduction I (3/4 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• sulfite oxidation III (2/3 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (4/6 steps found)
• assimilatory sulfate reduction II (1/3 steps found)
• assimilatory sulfate reduction III (1/3 steps found)
• selenate reduction (2/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (2/6 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (3/10 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

See Q72CI8 at UniProt or InterPro

Protein Sequence (427 amino acids)

>DVU1295 sulfate adenylyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSKLVPAHGGKGLVCCLLEGADREAELKKAAGLKQIEISSRAKGDLIMMGIGGFSPLNGF
MKKADWKSVCEKMTLADGTFWPVPVTLDVSKDDAAAIKPGQEIALVRKGETFATMLVEEI
YEMTEADKKWECELVFKGEGPDSQKFWEVALDDHPGVKMVMEQKEFNIAGTVKVLSEGEF
PTKFAGVYKRPAELRKEMEERGWANVAALQLRNPMHRSHEFLAKIAIEVCDGVVIHSLVG
SLKPGDIPAEVRVRCIDTLVEKYFVKENVIQAGYPLDMRYAGPREGLLHATFRQNYGINR
MIIGRDHAGVGDFYGMFEAQTIFNKIPYINEACPTPGKALLCEPLKIDWTFYCYKCDGMA
SLRTCPHGKEDRVILSGTKLRKALSEGAEVVDHFGRDEVLVILREYYSGLTEKVEVKMQQ
AASGSVM