Protein Info for DVU1282 in Desulfovibrio vulgaris Hildenborough JW710

Name: glmM
Annotation: phosphoglucosamine mutase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 3 to 133 (131 residues), 148.5 bits, E=2.1e-47
• TIGR01455: phosphoglucosamine mutase
  • amino acids 6 to 446 (441 residues), 624.2 bits, E=5.6e-192
• PF02879: PGM_PMM_II
  • amino acids 161 to 257 (97 residues), 60.5 bits, E=4.2e-20
• PF02880: PGM_PMM_III
  • amino acids 261 to 369 (109 residues), 139.9 bits, E=8.1e-45
• PF00408: PGM_PMM_IV
  • amino acids 377 to 443 (67 residues), 61.2 bits, E=1.6e-20

Best Hits

Swiss-Prot: 100% identical to GLMM_DESVH: Phosphoglucosamine mutase (glmM) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to dvl:Dvul_1783)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• starch degradation V (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• starch degradation III (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• chitin biosynthesis (5/9 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• starch biosynthesis (5/10 steps found)
• peptidoglycan recycling I (7/14 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

See Q72CK1 at UniProt or InterPro

Protein Sequence (450 amino acids)

>DVU1282 phosphoglucosamine mutase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGRRLFGTDGLRGQVNIYPMTADMALRLGLAAGTRFRNGNRRHRVVIGKDTRLSGYMFES
ALTAGLCAAGMDVFQVGPLPTPAISFLTRNMRADLGVVISASHNPFMDNGIKFFDRSGFK
LPDDVENQMTDMVLDPDWQWDYPASEKVGRAYKIADAPGRYIVYIKSSFPADLTLDGLRV
VIDCANGANYKVAPLALEELGAEVIKLGTEPNGLNINHQCGSLYPEVVAAKVRETRADIG
LALDGDADRLIVVDEKGTILDGDQIMALCAQDLMAKGKLPGNMLVATVMSNMALEVFMKE
HGGTLLRTAVGDRYVVEAMRQHGALLGGEQSGHLIFREYSTTGDGLLAALQILRIMRERG
KPLSELAGQLQLFPQQLINVHVERKIPFAECQPVADAVAAIETELGDRGRVLLRYSGTES
VCRVMVEGEHPEQVARLAEMLAETVQKHLR