Protein Info for DVU1280 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein TIGR00159 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details PF19293: CdaA_N" amino acids 7 to 84 (78 residues), 42.2 bits, see alignment E=7.7e-15 TIGR00159: TIGR00159 family protein" amino acids 13 to 241 (229 residues), 246 bits, see alignment E=1.8e-77 PF02457: DAC" amino acids 113 to 228 (116 residues), 143.3 bits, see alignment E=2.7e-46

Best Hits

Swiss-Prot: 43% identical to CDAA_BACSU: Cyclic di-AMP synthase CdaA (cdaA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1280)

Predicted SEED Role

"Diadenylate cyclase spyDAC; Bacterial checkpoint controller DisA with nucleotide-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CK3 at UniProt or InterPro

Protein Sequence (248 amino acids)

>DVU1280 conserved hypothetical protein TIGR00159 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLLFDTVTVGWRDLLDMALVAVLFYRVILLVKDTRAVSAIYGLLLLVVVYFVSRELGLYT
LGWLLENFLGSLFLVIIVLFQRDIRQALTDMGARSFRRRRSTEDEHLNEIIGAALYLAQR
RIGALIVIERNVALGDMLERGVKLGAQVSRELLITIFFPKTPLHDGAVIIRGREIAAAAC
ILPLAAVTERQDFGTRHRAALGITEESDAVAVVVSEERGAITVAVGGKLTTSLDATRLKR
VLRNILEK