Protein Info for DVU1278 in Desulfovibrio vulgaris Hildenborough JW710

Name: ftsH
Annotation: cell division protein FtsH (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details PF06480: FtsH_ext" amino acids 9 to 95 (87 residues), 58.4 bits, see alignment E=2.2e-19 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 101 to 592 (492 residues), 779.9 bits, see alignment E=5.2e-239 PF06068: TIP49" amino acids 155 to 222 (68 residues), 24 bits, see alignment E=6.3e-09 PF07728: AAA_5" amino acids 188 to 310 (123 residues), 24.4 bits, see alignment E=7.8e-09 PF00004: AAA" amino acids 189 to 321 (133 residues), 159.1 bits, see alignment E=2.5e-50 PF17862: AAA_lid_3" amino acids 345 to 387 (43 residues), 48.1 bits, see alignment 1.9e-16 PF01434: Peptidase_M41" amino acids 403 to 589 (187 residues), 241.4 bits, see alignment E=2.1e-75

Best Hits

Swiss-Prot: 63% identical to FTSH_MAGMM: ATP-dependent zinc metalloprotease FtsH (ftsH) from Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to dvl:Dvul_1787)

MetaCyc: 60% identical to ATP-dependent zinc metalloprotease FtsH (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CK5 at UniProt or InterPro

Protein Sequence (656 amino acids)

>DVU1278 cell division protein FtsH (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNQFSRNLVLWATISLLMVVLFNLFNQPQGTQQRVTYSEFLQRVEKGEVVEVTIQGQKLS
GKTTEGKPFQTFAPEDPSLVSRLLDKKIEVKAEPQEEAAWYMTLLVSWFPMLLLIGVWIF
FMRQMQGGGGKAMSFGRSRARMITQESARVTFEDVAGVDEAKEELSEVVEFLSNPRKFTR
LGGRIPKGVLLVGPPGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFMQ
GKKNAPCLIFIDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFESNEGVILIAATNR
PDVLDPALLRPGRFDRQVVVPTPDVRGRKRILEVHGRRTPLSSGVNLEIIAKGTPGFSGA
DLENLVNEAALQAAKLNKDVVDMGDFEYAKDKVLMGKERRSLILSDEEKRITAYHEAGHA
LAAKLIPGSDPIHKVTIIPRGRALGVTMQLPEGDRHGYSRNYLLGNLVVLLGGRVAEEII
FSDVTTGAGNDIDRATKMARKMVCEWGMSEAIGPLAIGEQGEEVFIGREWAHSRNFSEET
ARLVDAEVKRIIEEARQRCHTLLEENLTALHDIANALLERETISGDDIDILMRGEKLPPE
RGNGGAPANSGTTPPAGNATDGAKAAQSPQASEDAATPAEEFTLEAEEPEKRDDRA