Protein Info for DVU1272 in Desulfovibrio vulgaris Hildenborough JW710

Name: gspE
Annotation: general secretion pathway protein E, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 PF05157: MshEN" amino acids 61 to 143 (83 residues), 64.1 bits, see alignment E=9.6e-22 PF00437: T2SSE" amino acids 180 to 565 (386 residues), 441.5 bits, see alignment E=1.9e-136

Best Hits

KEGG orthology group: K02652, type IV pilus assembly protein PilB (inferred from 100% identity to dvu:DVU1272)

Predicted SEED Role

"Type IV fimbrial assembly, ATPase PilB" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CL1 at UniProt or InterPro

Protein Sequence (573 amino acids)

>DVU1272 general secretion pathway protein E, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRKRVRLGELLVEAGIISDEQLKVALRDHKKSGLRLGQFLIKTGVCREGDVVATVSRQLR
IDRYSPQDFPLSLNMAERLPLETAQKCNAVPLQQHGHVLVVAMTDPLDIDACDTIEFATN
SEVEPVICTEQEFNQLFSAVYGMFTNLDGVIESLGDLHTATAAKTETEDRDVALEELASQ
ADLAPVVRLVNSILAQAVREGASDVHISPEKDSRQVRFRIDGKLREAPAPPKNVAPAMVS
RLKILGNMDIAVTRVPQDGRFTMNLDNREINVRVSSIPTIYGENMVLRLLDMSGRDYTLD
QLGMEQTDHTVIKRVIHKPYGMILSTGPTGSGKSTSLYAILKSINTPEINIITLEDPVEY
RIGGIRQVQLNRKAGMTFASGLRSILRQDPDVVMVGEIRDAETASIAVQAALTGHLVLST
LHTNDAAGAVTRLIDMGIEPFLVSSVMLASFAQRLVRRVCPNCAEPYDPPHAALAAFGID
PAEGHDGRSRFLKGRGCFHCAHTGYRGRTGLFEILPMVPEIQELVVRRSSTQVIANTAIE
AGLMRTLVQDAALKVRAGITTVEEAATAVMLQG