Protein Info for DVU1264 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: transglycosylase SLT domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 44 to 62 (19 residues), see Phobius details PF13511: DUF4124" amino acids 86 to 109 (24 residues), 25.1 bits, see alignment (E = 1.7e-09) PF01464: SLT" amino acids 132 to 229 (98 residues), 98.4 bits, see alignment E=2e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1264)

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CL9 at UniProt or InterPro

Protein Sequence (253 amino acids)

>DVU1264 transglycosylase SLT domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLPFTTNEHLHVPRCCTVLYYAVTLRLRSLLRRFRQRSATGRQPLPALTAAFILLASTLP
ILPEETGRRGDSGRAGIAFAGEERVTIYKYVDEHGVVHLTNRPCGDGRYRVFGRFRVHDL
VRTVGTRGIHSLADKYGKRHGLDPNLVEAVIAVESNYDPTAVSSAGAQGLMQIMPGTQKD
LGVEAPFDPDANVEGGVRYLKSLMQRFGDTRLALAAYNAGPERVARCGGIPAIPETQNYV
TKVMATYERLSRR