Protein Info for DVU1255 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: Sua5/YciO/YrdC/YwlC family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 8 to 194 (187 residues), 139 bits, see alignment E=5.8e-45 PF01300: Sua5_yciO_yrdC" amino acids 15 to 192 (178 residues), 146 bits, see alignment E=4.3e-47

Best Hits

KEGG orthology group: K07566, putative translation factor (inferred from 100% identity to dvl:Dvul_1808)

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CM8 at UniProt or InterPro

Protein Sequence (210 amino acids)

>DVU1255 Sua5/YciO/YrdC/YwlC family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSAELLTNIADAVRLLAGGGVLVYPTETFFGIGCDVRDARAVDAVFRAKRRQSGMALPVI
LGDASQLGMVTRGHGAVEAALARDFWPGPLSILCPALPELPDTLTGGTGRVAVRVSPHPA
AMALALGLGAPLAASSANVSGRAAVVRVADLDRELLSGVDGVYDAPPQPAGGLPSTLVDV
LTDGTLRILREGAVPRAALVSKGYEVVSPC