Protein Info for DVU1248 in Desulfovibrio vulgaris Hildenborough JW710

Name: argS
Annotation: arginyl-tRNA synthetase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 527 to 546 (20 residues), see Phobius details TIGR00456: arginine--tRNA ligase" amino acids 4 to 551 (548 residues), 452.7 bits, see alignment E=8.1e-140 PF03485: Arg_tRNA_synt_N" amino acids 6 to 87 (82 residues), 73.5 bits, see alignment E=2.7e-24 PF00750: tRNA-synt_1d" amino acids 112 to 397 (286 residues), 94.2 bits, see alignment E=1.2e-30 PF05746: DALR_1" amino acids 429 to 551 (123 residues), 105.6 bits, see alignment E=2.6e-34

Best Hits

Swiss-Prot: 100% identical to SYR_DESVH: Arginine--tRNA ligase (argS) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 100% identity to dvu:DVU1248)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CN5 at UniProt or InterPro

Protein Sequence (551 amino acids)

>DVU1248 arginyl-tRNA synthetase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRAKKQLLAALQDIVKDMGLAWPEKATIDTPKATGFGDLAANIALVLAKQAGQNPRELAT
RIADALRNRDADITAIDIAGPGFLNVTYSQDFWRETILRAQEAGSAFGSSDTGAGRKVQV
EYVSANPTGPLHIGHGRGAAVGDSLARIMRFAGYDVSTEYYINDAGRQMRLLGLSVWVRA
KELAGRPVTLPEDFYRGDYIKDIARELMEKEPGLLDLDDAAGEDRCFAYAMSSILDGIKQ
DLADFRVEHQVWFSERSLVEGGAVEKTFNRLKEAGLAFEQDGALWFRTTDFGDDKDRVLR
KSDGTLTYFSSDIAYHDNKYDRGFDLVVDIWGADHHGYIPRMRAAVAALGRKPEAFDVVL
IQLVNLLRGGELVAMSTRAGQFETLADVVKETGADAARFMFLSRKSDSPLDFDLELVKQR
TMDNPVYYVQYAHARVCSVLRKAAERGIEMPAQLDGASLAPLSGDDEMELLRLLDRFEET
VAGAATALAPHHISHYLMEVAGALHSYYARQPILNATEQDVIVPRLALLRAVGCVLANGL
SLLGVSAPESM