Protein Info for DVU1246 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 154 to 183 (30 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 14 to 266 (253 residues), 245.2 bits, see alignment E=4.4e-77 PF02405: MlaE" amino acids 49 to 264 (216 residues), 265.6 bits, see alignment E=1.5e-83

Best Hits

Swiss-Prot: 38% identical to Y041_RICTY: Probable ABC transporter permease protein RT0041 (RT0041) from Rickettsia typhi (strain ATCC VR-144 / Wilmington)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to dvu:DVU1246)

Predicted SEED Role

"FIG00607492: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CN7 at UniProt or InterPro

Protein Sequence (267 amino acids)

>DVU1246 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTNPPERDNPVTALGRSFLRLLGELGAMFIFMLDGFRHIFASTKQLPKIVNQVYVIGYKS
LFVILLIGIFTGMVLGLQGYYTLVKFGSEGLLGAAVALTLIRELGPVLTAIMVTGRAGSS
MAAEIGVMRITDQIDALDVMDINPMGYLVSPRIAASLVAFPLLTALFDVIGIIGGYVTGV
MLLGINEGVYFHRIATSVELADVTGGFMKSLLFALIVSTVSCYQGYFTHMRRDGMGPEGV
SNSTTSAVVMSCVLVLVADYVLTSFLL