Protein Info for DVU1245 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF00005: ABC_tran" amino acids 25 to 174 (150 residues), 106.9 bits, see alignment E=7e-35

Best Hits

Swiss-Prot: 44% identical to MLAF_ECOLI: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Escherichia coli (strain K12)

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 100% identity to dvl:Dvul_1817)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CN8 at UniProt or InterPro

Protein Sequence (274 amino acids)

>DVU1245 ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDTTTAWDIRLEGLRLGYGEKVVLEDVTATLPAGRISMILGGSGCGKSTLLRHILGLQR
PLSGRVLLGGNDLFALSGIEFRRTRRRMGVLFQDGALLGALTLGDNVALPLKEHTRLPAT
TIREVVLHTLGLVGLSDFADYYPSQLSGGMRKRAGLARAIVMHPPILLCDEPTSGLDPIN
AAQMDRLLLDMKAHFPEMTTVVVSHDLQSLRMIADHALVLHDGKAVFSGSYHDLQATRDP
YLRDFLDRTPAADNAMRPALSPEVRAALDAWLAR