Protein Info for DVU1231 in Desulfovibrio vulgaris Hildenborough JW710

Name: amt
Annotation: ammonium transporter (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 5 to 400 (396 residues), 466.7 bits, see alignment E=3.3e-144 PF00909: Ammonium_transp" amino acids 7 to 400 (394 residues), 426 bits, see alignment E=6.6e-132

Best Hits

Swiss-Prot: 56% identical to AMTB_BACSU: Ammonium transporter (nrgA) from Bacillus subtilis (strain 168)

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 100% identity to dvl:Dvul_1831)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CQ2 at UniProt or InterPro

Protein Sequence (402 amino acids)

>DVU1231 ammonium transporter (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNAADTAFILICAALVMLMTPGLALFYGGLVRAKNVLSTTMHSFVLVGVASVVWAIIGYT
LAFGPDVAGVIGGLDHLFLKGVGMEPSEAAKTIPHLAFMVFQCMFAVITPALISGAYAER
ISFRAMLLFSVLWLVLVYAPMAHWVWGGGWMFKMGALDFAGGAVVHMSSAAAALAAAHVL
GRREGYGREPFVPHNLPMTVLGAGILWFGWFGFNAGSALAANGLAAMAFVTTHLATAAGV
MGWLAVEWMHSGKPTTLGAASGAVAGLVAITPAAGFVEPMPAMIIGFGGGMLCYGGVLMK
KVFKYDDALDVVGVHGVGGTWGALATGLFASEAVNGVNGLFYGNPGQLWTQFLSVVATWL
FCYLMSRGIFHAVDALMGLRVTVDAERAGLDVSEHNERAYEQ