Protein Info for DVU1228 in Desulfovibrio vulgaris Hildenborough JW710

Name: tpX
Annotation: thiol peroxidase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF08534: Redoxin" amino acids 25 to 165 (141 residues), 90.7 bits, see alignment E=8.1e-30 PF00578: AhpC-TSA" amino acids 25 to 148 (124 residues), 76.6 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 65% identical to TPX_BACHD: Thiol peroxidase (tpx) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K11065, thiol peroxidase, atypical 2-Cys peroxiredoxin [EC: 1.11.1.15] (inferred from 100% identity to dvu:DVU1228)

MetaCyc: 44% identical to lipid hydroperoxide peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Tpx-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CQ5 at UniProt or InterPro

Protein Sequence (172 amino acids)

>DVU1228 thiol peroxidase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTTERTGIITFKGNGLTLLGTPAGVGDKAPSFNVLANDLSPRTLGDYKGKVVIISAVPSL
DTGVCDMETRRFNQEAANLGEDVKILTVSCDLPFAQARWCGAAGVQAVETLSDHKDLSFG
MAYGVVIKELRLLTRAVFVVDRNGTITHAQIVPEVTTEPDYAGAIAAAKKAI