Protein Info for DVU1217 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: MATE efflux family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 405 to 424 (20 residues), see Phobius details amino acids 436 to 455 (20 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 31 to 437 (407 residues), 211.3 bits, see alignment E=1.1e-66 PF01554: MatE" amino acids 31 to 190 (160 residues), 79.4 bits, see alignment E=2.6e-26 amino acids 256 to 420 (165 residues), 85.2 bits, see alignment E=4.2e-28 PF14667: Polysacc_synt_C" amino acids 144 to 273 (130 residues), 31.8 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 100% identity to dvl:Dvul_1841)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CR6 at UniProt or InterPro

Protein Sequence (469 amino acids)

>DVU1217 MATE efflux family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSKFPSSFAEVRARWREPGGYREVLHIGLPLVAGMASTTVMQFTDRLFLSHYSVESIAA
ALPAGLASLLLLLTCMGVTGYASVFIAQYIGAGQPHRVGGVLWQSLIASLVFGGLLAMTS
LLAEPIFSLAGHAPELQRLEETYFIILQLGSVLSLVGNSLGTFFSGRGRTRPVMLANIAA
AVVNVPLDYVLINGVWFFPEMGIAGAAVATVMGWGVTAVLLAIAVFNRDHETRFGVRSQW
RFDAVMMRRLMRYGLPSGVNFFMELFAVTWFVFVVGTLGEVALAATNIAFSINSVAFLPT
VGLNIAVGTMVGQAMGRGDPDGAARATGSTLHVAMAWMTALALVFVLLPGPLVDLFRPDN
LTPAAYADIRETTARLLAYVAFYCLFDSLTIIFCGALKGAGDTAFVMWNMTVGCIFVLII
PAYALRALGWWSLDSLWLVFSVYVSVLAVASYVRFRLGRWRKLRLVHPA