Protein Info for DVU1215 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: PAP2 family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 47 to 72 (26 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details PF01569: PAP2" amino acids 88 to 199 (112 residues), 71.3 bits, see alignment E=3.3e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1215)

Predicted SEED Role

"PAP2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CR8 at UniProt or InterPro

Protein Sequence (204 amino acids)

>DVU1215 PAP2 family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRPTILPAYILATLPLVMALLATAVSIGTGDEVVNFFRQYRQAHPALTACMQVITDFGN
PLLYLVYGAIFFRARKRGDRHDMRFVAVYIVVQLLVSFLAVRILKIGFGMPRPGTEGPAI
PFSFKGVYNSFPSGHTTEIVGAVVPLAWRCKALLPTLALGIYMGIVGYSRIYLGMHHITD
VFAGLLLGSVAAWIIHRLADRTPS