Protein Info for DVU1214 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: dolichyl-phosphate-mannose-protein mannosyltransferase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 transmembrane" amino acids 63 to 84 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 228 to 259 (32 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details amino acids 415 to 440 (26 residues), see Phobius details amino acids 452 to 477 (26 residues), see Phobius details amino acids 489 to 508 (20 residues), see Phobius details PF02366: PMT" amino acids 117 to 270 (154 residues), 32.9 bits, see alignment E=5.2e-12 PF13231: PMT_2" amino acids 124 to 283 (160 residues), 51.4 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1843)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CR9 at UniProt or InterPro

Protein Sequence (724 amino acids)

>DVU1214 dolichyl-phosphate-mannose-protein mannosyltransferase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNEPASATLGTTSESKGVASSGSNATAAPSGTTDTPGATTQKASQATATASGTPQRSMAA
RAFDLLAIFPLLPLTILLVLQTMGGFDARALWFSDEVRHADVYQNVIDAGKWLVLQLNGV
PYPDKPPVYFWFLAALDMIPGVRPPMLFLLGAAVSGLAVLWATYALARATGNDKATGLAA
GLILLSGFYFLGVTHYARMDLLFTAVITLSHLCMYKGWRRESAPAWLIAGYALAAVATLI
KGPLGLAFPVLSSVLFVLWQGKVRRLHNRDAVAGFAVMLVILLGWVAAAWMTGESEYLRN
IFQDQIVKRATATWHHAQPWWHYLATFPAAWLPWTLLLLTAPWGRVLRNPVRDALDTRKP
EGLGTAYLWISLLSGVALLSAVSIKIVIYLLPLFPILAIITARCLLRLPATNSRVFYLLV
SLLLFILAVGLGAVAALPLLPGSVRDALPPQALALLDIVAGAPVLGGVCLIFALLLFKAT
DRSQPRGALLTLVLFTTVFVQPMALYTAPSLDPVMSPKAQAEIIGAHAKEGYHPLSYRVY
PGTYTFYAGTQLEEITQRDWALLDAALSAHPRAVIAMRLDDWEQWPNRPASAREIQRQWI
VDRQFVVVVTESAAPDAAAATPEGAPVPTVETPAAAGTEGHAVPDAAPAPAVPVEAPASP
AVETPATPSASPAPTDVAPAPQPEAITAPDAAAQDQPALPAMPAPQPVAPQQTGNDATAP
GAPE