Protein Info for DVU1213 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: rhomboid family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 110 to 129 (20 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details PF01694: Rhomboid" amino acids 160 to 298 (139 residues), 66.8 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1213)

Predicted SEED Role

"rhomboid family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CS0 at UniProt or InterPro

Protein Sequence (337 amino acids)

>DVU1213 rhomboid family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIPPPRPRRVRIGGRPRIRLRRRPGGASPWWRDITCAVPGGGETSPVAPHRLVQWRLVLS
SKRIPFRQVQRGSRVGLYVPIVLERMARQEIAAYELEGVRPSVERRPVSFSNAHVTLMVL
LLLVLWHGVRMGWWKLFGLATVPAPDAWSSMGALDVYRVIERGEWFRAVTALTLHADSPH
LFSNILFGGAFLVPLCRRTGAGLGFMLTLCAGALGNVLNAVARPLSYVSLGSSTAMFGAV
GVLSGLLAFEDGGRGWRRMFVPLAAGVAVLGMLGTEGENTDVGAHLFGLLAGCVVGATAQ
LRLNRVGLPGFVGQVVLGALALVLCGLCWWLAFVARG