Protein Info for DVU1206 in Desulfovibrio vulgaris Hildenborough JW710

Name: fabG
Annotation: 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 53% identical to FABG_STAAR: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain MRSA252)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 99% identity to dvl:Dvul_1851)

MetaCyc: 41% identical to lyngbyatoxin A monooxygenase (Moorena producens)
1.14.13.-; 1.14.13.-

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (47/53 steps found)
palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
oleate biosynthesis IV (anaerobic) (13/14 steps found)
superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
biotin biosynthesis I (13/15 steps found)
palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
8-amino-7-oxononanoate biosynthesis IV (5/5 steps found)
gondoate biosynthesis (anaerobic) (4/4 steps found)
8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
(5Z)-dodecenoate biosynthesis I (5/6 steps found)
stearate biosynthesis II (bacteria and plants) (5/6 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (12/16 steps found)
cis-vaccenate biosynthesis (4/5 steps found)
fatty acid elongation -- saturated (4/5 steps found)
octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
palmitate biosynthesis III (21/29 steps found)
(5Z)-dodecenoate biosynthesis II (4/6 steps found)
stearate biosynthesis IV (4/6 steps found)
anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
lyngbyatoxin biosynthesis (2/5 steps found)
petroselinate biosynthesis (2/6 steps found)
2-allylmalonyl-CoA biosynthesis (2/8 steps found)
streptorubin B biosynthesis (20/34 steps found)
mycolate biosynthesis (17/205 steps found)
superpathway of mycolate biosynthesis (18/239 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CS7 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DVU1206 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPFVKPQNARFVMSELTPTAIVTGGSRGIGKAVAETLARAGLQVFLTYVSKPDEAEAVAA
GIRDAGGSATAFRLDVSDAAAVAAFFQSEIKDKVRLDVLVNNAGITKDGLIMRMKDEDFE
RVLDVNLCGAFTCLREASKLMTRQRLGRIINITSVVGQMGNAGQANYCAAKAGLIGLTKS
AAKELAARNVTVNAVAPGFIETDMTAGLPEEVRKAYVEAIPLRRLGSAQDIADAVAFLAS
ERASYITGQVLAVNGGMYC