Protein Info for DVU1204 in Desulfovibrio vulgaris Hildenborough JW710

Name: fabF
Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase II (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 4 to 247 (244 residues), 207 bits, see alignment E=3.9e-65 TIGR03150: beta-ketoacyl-acyl-carrier-protein synthase II" amino acids 4 to 411 (408 residues), 616.6 bits, see alignment E=8.4e-190 PF02801: Ketoacyl-synt_C" amino acids 256 to 370 (115 residues), 122.9 bits, see alignment E=7.3e-40

Best Hits

Swiss-Prot: 56% identical to FABF_BACSU: 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF) from Bacillus subtilis (strain 168)

KEGG orthology group: K09458, 3-oxoacyl-[acyl-carrier-protein] synthase II [EC: 2.3.1.179] (inferred from 100% identity to dvl:Dvul_1853)

MetaCyc: 56% identical to beta-ketoacyl-acyl carrier protein synthase II (Bacillus subtilis subtilis 168)
Beta-ketoacyl-acyl-carrier-protein synthase II. [EC: 2.3.1.179, 2.3.1.41]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.41

Use Curated BLAST to search for 2.3.1.179 or 2.3.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CS9 at UniProt or InterPro

Protein Sequence (415 amino acids)

>DVU1204 3-oxoacyl-(acyl-carrier-protein) synthase II (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTGKRVVVTGLAALTPLGNDIETSWDNLVAGKSGIGPITRFDATEYASRIAGEVKDFDPE
KFMPAKQARRMDRFVQFAVATGKMLVEHSGLVIDESNADRVGVLLGVGLGGLETIEVFHT
KLMEAGPNKVSPFMIPMLISNMAPGQVSIFTGARGPNVVMTSACASATHAIGYAFSEIKL
GRIDAAITGGVESTITPMGVSGFTALKALSTAHNDSPEKASRPFDKERDGFVLGEGSGML
MLESLDSALARGATIYAEVVGFGASGDAYHMTAPHESGDGMALAMRNAVREAGIPVEAVD
HINAHATSTHLNDLCETRAIKQVFGQHAYNIAITANKSMTGHLLGAAGGLESVFTVLTLH
RGIIPGTINHETPDPECDLNYMTEGSKEMQAHYALCNSFGFGGTNASLLFKRYED