Protein Info for DVU1200 in Desulfovibrio vulgaris Hildenborough JW710

Name: ribE
Annotation: riboflavin synthase, alpha subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 TIGR00187: riboflavin synthase, alpha subunit" amino acids 1 to 194 (194 residues), 184.3 bits, see alignment E=7.6e-59 PF00677: Lum_binding" amino acids 3 to 86 (84 residues), 78.7 bits, see alignment E=1.3e-26 amino acids 99 to 183 (85 residues), 81.3 bits, see alignment E=2.1e-27

Best Hits

Swiss-Prot: 42% identical to RISA_ACTPL: Riboflavin synthase (ribE) from Actinobacillus pleuropneumoniae

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 100% identity to dvu:DVU1200)

MetaCyc: 38% identical to riboflavin synthase monomer (Bacillus subtilis)
Riboflavin synthase. [EC: 2.5.1.9]

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CT3 at UniProt or InterPro

Protein Sequence (220 amino acids)

>DVU1200 riboflavin synthase, alpha subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFTGIIQGQGEVVAVEPMGGETRLRLRALFALDAIVKGESIATNGTCLTVETYGDRWFTA
YASSETMQRTNLGDLRQGARVNLERALAVGDRLGGHIVSGHVDCVAEVRSITQAGLSKVY
RLGFPSAFGPQVIPKGSVALDGISLTVNHCGPDFLEVNVIPETQGVTTIASWKPGTRVNM
ETDVIGKYVQNMLAPWNTPHTGEDAPSGRITLDFLRENGF