Protein Info for DVU1190 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box/GGDEF domain/EAL domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 926 PF13188: PAS_8" amino acids 79 to 107 (29 residues), 15.2 bits, see alignment (E = 6.7e-06) amino acids 367 to 420 (54 residues), 35.3 bits, see alignment 3.1e-12 PF13185: GAF_2" amino acids 214 to 353 (140 residues), 45.8 bits, see alignment E=2.8e-15 PF01590: GAF" amino acids 216 to 353 (138 residues), 29 bits, see alignment E=5.7e-10 TIGR00229: PAS domain S-box protein" amino acids 363 to 489 (127 residues), 88.4 bits, see alignment E=4.1e-29 PF00989: PAS" amino acids 368 to 479 (112 residues), 36.5 bits, see alignment E=1.8e-12 PF08448: PAS_4" amino acids 373 to 483 (111 residues), 49.1 bits, see alignment E=2.4e-16 PF13426: PAS_9" amino acids 379 to 481 (103 residues), 33.6 bits, see alignment E=1.6e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 489 to 655 (167 residues), 143.1 bits, see alignment E=6.8e-46 PF00990: GGDEF" amino acids 493 to 650 (158 residues), 164.7 bits, see alignment E=6.2e-52 PF00563: EAL" amino acids 671 to 905 (235 residues), 235.4 bits, see alignment E=2.4e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1190)

Predicted SEED Role

"sensory box/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CU3 at UniProt or InterPro

Protein Sequence (926 amino acids)

>DVU1190 sensory box/GGDEF domain/EAL domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTLPDSRESREMPSGKEGGLPGSAHEAPIVARGDVSRSSDSTGLEYASAAAPVGDLLRA
VRGGMHGVTASRGGVSGANASVGVAVFDGAGNLLEMNPQLARLLGCGDCPPPSLFSSGFV
GLEGTTEVLSLFMRIAAGKVPGGMCRKRFCGEGGKTFTARVTLYAEHDISGRVARIVKLV
QPEAGEDASVPGADVADKVRAALDLIAYARLNERDLPSLVARFHRILRSLMPFEHCYVAL
CDGPGGMVSYPYYRDIGVVSRDARAFGDGISEYIYTNGAALVLDAQGIESLERAGRFRLR
CARPRHWIGVPLRTHGGEVIGVFAGKSYREGDAYTVEDRLLLELVSGHVAGAIIERRKAF
ALQESEARFRAIFEHSAAGICLVGRDGLLMDANPAFEELLGLTRAEVVGCRFDAFLPVKA
ASELDSTCRSSFAEGRDTVSLRLPFLRVDGEQRWGRQIVTAVRDVAGDVAFVLAQVEDIT
EQQQTEARLTRMAFHDALTGLPNRVLFLDRVETALRRARRHETYHFAVLFLDLDRFKVVN
DSLGHKAGDELLRQFARRLEPCLREVDTMARFGGDEFAILLDDMSDVDESVNIIERLQAA
LRQPFLVQGMEVYTGASIGAVLRARDYTQAEDILRDADIAMYRAKDSGKGRFVVFESSAA
PGAQDILRRENELRRALDGDEIELYFQPIVALRTGRITGLEALVRWQHPEQGLLAPGTFI
PLAEESNLICDLDMHVFRKGCLAVVALQEAFEGPLAVNINISARSFRRLRMVQDITDILR
ETGCPPQMVKLEITENLLLTGLEVTDKLWRLKDLGLSLVLDDFGTGYSSLNYLRQFPMDI
LKIDRSFISRVHEERAARGIVESIANLGRTLGLGVVAEGIEVSEQAEILLEVGCPHGQGY
FYSRPQPFDRMLRTLERRRPLPLSAG