Protein Info for DVU1185 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: colicin V production family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 102 to 127 (26 residues), see Phobius details PF02674: Colicin_V" amino acids 6 to 146 (141 residues), 121.8 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: K03558, membrane protein required for colicin V production (inferred from 100% identity to dvu:DVU1185)

Predicted SEED Role

"Colicin V production protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CU8 at UniProt or InterPro

Protein Sequence (159 amino acids)

>DVU1185 colicin V production family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTPNYLDIAFLAVLGLFTLRGLFRGLVEEVAGLVGVIGGFWLANRHHADAAAYVGRVVED
PAWVGVLSYVVVFLGVLLVVSIVARIIRKLLVLSFAGWLDHLAGGAVGVAKGVIICSILL
AVLMHFLPDASFVRDSRVIPHLAKVTSFIKGYLPQQIVN