Protein Info for DVU1181 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00072: Response_reg" amino acids 10 to 112 (103 residues), 90.9 bits, see alignment E=1.2e-29 PF13487: HD_5" amino acids 169 to 327 (159 residues), 132 bits, see alignment E=4e-42 TIGR00277: HDIG domain" amino acids 180 to 270 (91 residues), 30.6 bits, see alignment E=1.2e-11 PF01966: HD" amino acids 182 to 301 (120 residues), 72.8 bits, see alignment E=6e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1181)

Predicted SEED Role

"response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CV2 at UniProt or InterPro

Protein Sequence (356 amino acids)

>DVU1181 response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQSAPAPATILIIDDDASVRMGLKALLEDEGFYVMDASSGPEGLSMFATSPPDLVLVDLA
MPDMNGRDVVRHLHSADPLVPVIVVSGTGVLEDAVGTLRDGAWDYVAKPIADTAGFVRLI
RRALERAALIAENTAYSNGLEQMVRQRTAELEAASSRLHTTLFATVESLSKLTNLKDAYT
EAHQCRVAIIATTIGEVLGYEGERLDGLRVAATLHDIGKLCIPSEFLTKPRGLDHHEMAF
LRQHPQFGYEILADIPFPSPVADIVLQHHERLDGSGYPAGLRGDAILAEARIIAVADVLE
AICSHRPYRPALPLSYAMSEIESGMGTLFCPQAAGVCLDLVRSDNPRLHAFLSTAS