Protein Info for DVU1169 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: methyl-accepting chemotaxis protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 804 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details PF02743: dCache_1" amino acids 52 to 275 (224 residues), 73.7 bits, see alignment E=5.2e-24 PF00672: HAMP" amino acids 338 to 384 (47 residues), 41.8 bits, see alignment 3.2e-14 PF00989: PAS" amino acids 394 to 505 (112 residues), 28.5 bits, see alignment E=4.1e-10 PF08448: PAS_4" amino acids 401 to 510 (110 residues), 25.4 bits, see alignment E=4.4e-09 PF13426: PAS_9" amino acids 405 to 507 (103 residues), 33.1 bits, see alignment E=1.8e-11 PF00015: MCPsignal" amino acids 587 to 768 (182 residues), 155.5 bits, see alignment E=3.8e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1169)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CW4 at UniProt or InterPro

Protein Sequence (804 amino acids)

>DVU1169 methyl-accepting chemotaxis protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNILKRYIAVRYIFSVICVLSLVGCIFGWYTYTTQVHREMDYNESFGEARLGDIAQALQD
WIGSQAQLAQVLARDESVIAACREPWNAEKAEQARKMLQGFHDAYGFYENIPLAANLPDG
RTFTVNVGGEERVIRDGAFFTDTVHGKTLGKGGAQLSFNRATREGRPYFISEVYPSLLRG
NPIFVIAAPVMDEGRNIGTIILAPRMDYFTDKYIKGATIGRTGHFFFVDDRGMFIAHRDR
AMILDKNAASTHGEYVRRLIDAKGSFIATDPAGVAYRYMSRRVDIPSDSIAHRWFLCSAQ
PVDEITASADDFLTMLLAGGGLLLVILGGVLILLTRAIVSKPLGKVVAYARAIASGSFDT
RLAVDRSDEIGELASTLSDMTVNIIGELQEETGFMQGILRGIQNPFAVVDATLHIRNCSQ
SMVATTGRTGDMADFVGMHISEFLFADRNRRALLHDVLEDGKPRKNVPFSYTSTVGEQFE
MIIDVMPIRDASGDIIGGITFWNDVTELHRRQRAVEMQRDTIEAAARQAGEVSEEAEATM
RTLAADIDETGRSSERQAQFIAESVVAIEELNATVREIADNASRTAHNAQDTKQQADNGA
AVVAESLRTMNNLRELVEEMRRELGGLGAQADSVGNVIKIINDIADQTNLLALNAAIEAA
RAGEAGRGFSVVADEVRKLAEKTVSATREVADAISAIQDGTRRCTASALRVEDETRNNVE
QAGRTDEALKSIVDLAGATSGMVTEIATAAEQQSAATEQIARSAADMGTMADETRNAMRQ
AAGNVQHMHGTISTLNGIITDMRR