Protein Info for DVU1134 in Desulfovibrio vulgaris Hildenborough JW710

Name: hupB
Annotation: DNA-binding protein HU, beta subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 PF00216: Bac_DNA_binding" amino acids 1 to 94 (94 residues), 90 bits, see alignment E=4.7e-30

Best Hits

Swiss-Prot: 42% identical to DBH2_BACHD: DNA-binding protein HU-1 (hup2) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K03530, DNA-binding protein HU-beta (inferred from 100% identity to dvu:DVU1134)

Predicted SEED Role

"integration host factor beta-subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CZ7 at UniProt or InterPro

Protein Sequence (95 amino acids)

>DVU1134 DNA-binding protein HU, beta subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNRKELVSAVQNTLERTGCKITRRDVERTLDVFGDVAAAELLEGGDVPLPVLGKLRSVER
AARAGRNPRTGESIAIPARRVVTFKAGKDLREALG