Protein Info for DVU1095 in Desulfovibrio vulgaris Hildenborough JW710

Name: argG
Annotation: argininosuccinate synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00032: argininosuccinate synthase
  • amino acids 6 to 394 (389 residues), 498.8 bits, E=6.9e-154
• PF00764: Arginosuc_synth
  • amino acids 6 to 167 (162 residues), 221.1 bits, E=8.3e-70
• PF20979: Arginosuc_syn_C
  • amino acids 175 to 391 (217 residues), 269.7 bits, E=1.9e-84

Best Hits

Swiss-Prot: 100% identical to ASSY_DESVH: Argininosuccinate synthase (argG) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 100% identity to dvl:Dvul_1900)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• canavanine biosynthesis (2/4 steps found)
• superpathway of arginine and polyamine biosynthesis (11/17 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See P61522 at UniProt or InterPro

Protein Sequence (396 amino acids)

>DVU1095 argininosuccinate synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSGIKKVVLAYSGGLDTSVILKWLAVTYNCEVVTLTADLGQEEDLDGVDDKAMRTGASRA
YVEDLQEEFARDFIFPMMRAGAVYEGRYLLGTSIARPLIAKRLVEIARAEGAQAVAHGAT
GKGNDQVRFELAVNALAPDLRVIAPWREWDLRSRTQLNAFAEEHGIPISSSAKQYSMDRN
MLHCSFEGGELEDPWNEPGPNSYVMAVPMEQAPDEAEYISIDFEHGNPVAVNGERLSPAA
LVKKLNSIGGRHGIGRLDMVENRFVGIKSRGVYETPGGTLIHIAHRDLEGICIDRETMHL
RDAMLPRYAAAIYNGFWFAPEREAMQAMIDVSQQRVTGTVRLKLYKGNAWPVGRQSPNTL
YCHDLATFEDCATYDHKDAAGFIKLQGLRIRGYKKG