Protein Info for DVU1093 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 3 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF00702: Hydrolase" amino acids 39 to 139 (101 residues), 39.8 bits, see alignment E=1e-13 PF13419: HAD_2" amino acids 43 to 140 (98 residues), 38.3 bits, see alignment E=2.3e-13 PF13242: Hydrolase_like" amino acids 101 to 144 (44 residues), 28.7 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to dvu:DVU1093)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D37 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DVU1093 HAD-superfamily hydrolase, subfamily IA, variant 3 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPDVPSHPSSSTHDKVLLFDWGGTLMRSMPRWQGTSAGWTREEAIPHAPETLHCLATGWR
MGLASNACESDEDPIRASLDTIGIGNLFEHIFTWRSVGSPKPWGPFWSHVLRNLKVAPAR
VVMVGDDWMGDVWGARQAGLCGVWFNPHSDEVREREGVRTIHDFRSLPDVLADLGF