Protein Info for DVU1078 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: R3H domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF14804: Jag_N" amino acids 7 to 56 (50 residues), 65.3 bits, see alignment 8.2e-22 PF13083: KH_KhpA-B" amino acids 296 to 351 (56 residues), 36.8 bits, see alignment 4.4e-13 PF01424: R3H" amino acids 363 to 423 (61 residues), 52.7 bits, see alignment E=5.5e-18

Best Hits

KEGG orthology group: K06346, spoIIIJ-associated protein (inferred from 100% identity to dvl:Dvul_1916)

Predicted SEED Role

"RNA-binding protein Jag"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D52 at UniProt or InterPro

Protein Sequence (430 amino acids)

>DVU1078 R3H domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDGYKDFQGKTLDEAIREACSYFDAPREKLEIDIIQDAKSGIFGLVGVRKAKIRARRVQL
KTTVEELVGRGREAASPAEASEGEGKARSSRRPAKPVREKRETASEDAPKASSADGDDAA
PSRQPRGERGRSDRQPREARAPKSEAAVAESDAGAAATEQSEAMDGEQRERTGRRRRRGG
RGRGRSQNGERAAQEATGTAEAEAQGTADAAPAQEPATPAPRGRGQNRPAPARRSAPPAA
SSVAASAEGFEDFADGGDDATPEGLPDIPLADLDQELVRSVALEVTGKLVAPIIGEAALT
VDLADGRIKVTVDCGDNSGLLIGREGQTLASIQYLASRIVARKLNAAVRVQLDTGDYRER
QDEKLRELAVSLAEKARATGKPQSTRPLSSYHRRVVHLALQEEEDIVTRSKGDGPLKRVI
VLKRRKSPAA