Protein Info for DVU1070 in Desulfovibrio vulgaris Hildenborough JW710

Name: rbsA
Annotation: branched chain amino acid ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 PF00005: ABC_tran" amino acids 51 to 196 (146 residues), 107.7 bits, see alignment E=7.4e-35 amino acids 295 to 450 (156 residues), 49.6 bits, see alignment E=6.4e-17

Best Hits

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to dvu:DVU1070)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D59 at UniProt or InterPro

Protein Sequence (524 amino acids)

>DVU1070 branched chain amino acid ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTVANANDTAPHADSTTPQTGRTGRALRHDVTPVVRLEGIGKSFGPVRANHDITLDIVPG
RIKALLGENGAGKSTLMSILSGRLAQDTGIIHVDGEAVRFRSPKDALKAGIGMVYQHFML
VDSMTVAENVLLGQSGAWLSPVHMSRVVAELAARYGLDIDPAARVCDLSMGERQRVEILK
LLYRDSRVLILDEPTAVLTPGETEQLFEALHRMAENGKAIVFISHKMQEVLALADEIAIL
RRGEVVDEFHESEVPGEAELANRMVGREVILEVAAEPLEPGDRVLHVDGLAGDGLKGLSF
EVRKGEVFAIAGVAGNGQRELVECVTGLRRPAEGEVELLGIPWRQFFTKAPRQGGLAYIP
EDRQGLATCLSLDLVDNFLLTARGCFTRGPFLDRKSADAAARDILAEYNVQPGRAEAPAR
SLSGGNLQKLVVGREFYRKPSLIVAENPTQGLDIAATEEVWARLLEVRSHAGVLLVSGDL
NEVLALADRVAVMYRGCFIGLLDRSDTNKVDAIGLMMAGVSCEG