Protein Info for DVU1058 in Desulfovibrio vulgaris Hildenborough JW710

Name: nikM
Annotation: component of nickel ABC transport system (Dmitry Rodionov)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 63 to 91 (29 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details PF01891: CbiM" amino acids 2 to 194 (193 residues), 208.3 bits, see alignment E=6e-66

Best Hits

KEGG orthology group: K02007, cobalt/nickel transport system permease protein (inferred from 100% identity to dvl:Dvul_1936)

Predicted SEED Role

"Substrate-specific component NikM of nickel ECF transporter" in subsystem ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D71 at UniProt or InterPro

Protein Sequence (204 amino acids)

>DVU1058 component of nickel ABC transport system (Dmitry Rodionov) (Desulfovibrio vulgaris Hildenborough JW710)
MHISEGVLPASVLLGGAALTAAGTALGLRRIDWDRVMTVALLAAAFFVASLIHVPVGPVS
AHLVLNGLIGVILGWAAFPAILVALLLQALLFQFGGLLVLGVNTFNMALPPVICHYLFRK
ALTGTSTPRTGAAFACGFLSVLLSASLTALSLGLAGEGFIPAAQSLLIAHLPVMVVEGCI
TALVIGFLYKVRPEVLDFSAQATR