Protein Info for DVU1056 in Desulfovibrio vulgaris Hildenborough JW710

Name: nikO
Annotation: component of nickel ABC transport system (Dmitry Rodionov)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00005: ABC_tran" amino acids 27 to 174 (148 residues), 102.1 bits, see alignment E=4e-33 PF13304: AAA_21" amino acids 144 to 199 (56 residues), 31.3 bits, see alignment E=2.2e-11

Best Hits

Swiss-Prot: 100% identical to Y1056_DESVH: Putative ABC transporter ATP-binding protein DVU_1056 (DVU_1056) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 100% identity to dvu:DVU1056)

Predicted SEED Role

"ATPase component NikO of energizing module of nickel ECF transporter" in subsystem ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D73 at UniProt or InterPro

Protein Sequence (273 amino acids)

>DVU1056 component of nickel ABC transport system (Dmitry Rodionov) (Desulfovibrio vulgaris Hildenborough JW710)
MTDTTGNPLLSLDDIHFTYPGTTAPVLRGATLHLAQGDRLGLLGHNGSGKTTLLHIAMGL
LRPESGTVHHRNAVAHDEASLAALRRDIGFLFQNADDQLFCPTVLEDVAFGPLNLGLSPE
QARERATQTLQGLGLEGFGARVTHRLSGGEKKMVALASVLSMQPTALLLDEPTNDLDPAT
RQRLIDVLNRMSATHIIISHDWDFLARTCTTFLTVDDGIVCTSRHTPHVHTHIHHGGEVA
HEHPSRGCCHQHDGSHHHAGHDDDHPHTSQTTE