Protein Info for DVU1052 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: CBS domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 28 to 29 (2 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details PF01595: CNNM" amino acids 19 to 189 (171 residues), 124.1 bits, see alignment E=5.3e-40 PF00571: CBS" amino acids 204 to 261 (58 residues), 23.1 bits, see alignment E=7.7e-09 amino acids 271 to 324 (54 residues), 33.7 bits, see alignment 3.7e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1052)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D77 at UniProt or InterPro

Protein Sequence (354 amino acids)

>DVU1052 CBS domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPPAASVFHIMLALVVAVTLSVVVSASCSITEAILYSVPWSHIEQLRKSGSPVGKLLFAM
RSRIEQPITAVLTLNTIANTAGAAIAGSYAAEVLSPDQMPAFAAGFTVLILVVSEILPKT
LGVAYARPLASVIAYPLRFLVILLMPVIWLGGWVTRAIMPASSGPHATEDDIRAIVSLSR
QAGGIQPHEEMSIRNILSLDRKHVHDIMTPRTVVFSLPADLTVEEAYEKPDFWHYSRIPV
FGEGNEDIVGIVMRRRVLQEVAADREGTRLADIMQPVHYALESQTLDRVLFQFLDARVHL
FVVLDEYGGLAGVVSLEDVLEEILGREIVDESDRVTDLRELARERRDAAIKANQ