Protein Info for DVU1051 in Desulfovibrio vulgaris Hildenborough JW710

Name: ccmE
Annotation: cytochrome c-type biogenesis protein CcmE (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details PF03100: CcmE" amino acids 34 to 133 (100 residues), 83.7 bits, see alignment E=4.9e-28

Best Hits

KEGG orthology group: K02197, cytochrome c-type biogenesis protein CcmE (inferred from 99% identity to dvl:Dvul_1942)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmE, heme chaperone" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D78 at UniProt or InterPro

Protein Sequence (137 amino acids)

>DVU1051 cytochrome c-type biogenesis protein CcmE (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAQKNSKSLYLVALALFLGGIGYLLFSGFTQNSVYFLNVSEALATPQDKLHTVRLFGTVA
ADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKA
RTLMTKCPSKYQKENRG