Protein Info for DVU1048 in Desulfovibrio vulgaris Hildenborough JW710

Name: ccmB
Annotation: cytochrome c-type biogenesis protein CcmB (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 222 (26 residues), see Phobius details PF03379: CcmB" amino acids 7 to 207 (201 residues), 59.7 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K02194, heme exporter protein B (inferred from 100% identity to dvu:DVU1048)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D81 at UniProt or InterPro

Protein Sequence (225 amino acids)

>DVU1048 cytochrome c-type biogenesis protein CcmB (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLKAASAIAMKDLRLVLARGTGLVQALLLGLLLIFVFSLSQQVGETMTPQGAAAIFWLAS
AFCQVLIYNTLYSIEEANGTRYGLLLAPVPVQSVWLGKALSGLLLLLAAQLVFLPATVVF
LGQKLSSLWDVGLLTVLLADVGIVALGSLLGALSQGQAARESLLSIVLFPLLVPVLLAGI
RVGAGAFSEEMVEGCAQWLGIIGAFDALFLGTGIVLFGFLYGGED