Protein Info for DVU1047 in Desulfovibrio vulgaris Hildenborough JW710

Name: ccmC
Annotation: cytochrome c-type biogenesis protein CcmC (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 26 to 167 (142 residues), 99.4 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: K02195, heme exporter protein C (inferred from 100% identity to dvl:Dvul_1946)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D82 at UniProt or InterPro

Protein Sequence (224 amino acids)

>DVU1047 cytochrome c-type biogenesis protein CcmC (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRNNWLAPLALAAGAGLAVCQYLIYVYAPVESMMGLVQKIFYTHLPLAWWSFVSFFTVFI
ASIAFLRTRDRRWDSLAGAAAEVGVLCSGLALVTGSIWGRHSWGVWWTWDPRLTTTLVMW
FVYAGYLVLRSMNLSRDRQATVSAVVGIAAFVDVPLVFLSARLWRSIHPAVFASRDGGLE
PEMKLTAVVCVAVFGLMWAALTGVRYMQTRQTDRLDTLATREAL