Protein Info for DVU1025 in Desulfovibrio vulgaris Hildenborough JW710

Name: upp
Annotation: uracil phosphoribosyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR01091: uracil phosphoribosyltransferase" amino acids 3 to 208 (206 residues), 285.9 bits, see alignment E=9.2e-90 PF14681: UPRTase" amino acids 5 to 207 (203 residues), 228.3 bits, see alignment E=7e-72 PF00156: Pribosyltran" amino acids 64 to 189 (126 residues), 44.8 bits, see alignment E=8.6e-16

Best Hits

Swiss-Prot: 100% identical to UPP_DESVH: Uracil phosphoribosyltransferase (upp) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 100% identity to dvl:Dvul_1968)

MetaCyc: 68% identical to uracil phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Uracil phosphoribosyltransferase. [EC: 2.4.2.9]

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DA4 at UniProt or InterPro

Protein Sequence (208 amino acids)

>DVU1025 uracil phosphoribosyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAVYVVDHPLVKHKLGRLRQHDVPVSEFRAIANELCRLLAYEATKDLETEKVSVQGWAGP
VEVDQIKGKKITAVPILRAGLGMLDGFLDMIPGAKVSVVGMFRNEETLEPVQYYTKLAKN
IDERMAVILDPMLATGGTLDATIDLLKNAGCPQIKGLFLVAAPEGLKRIVDKHPDVDIYV
AAVDERLNEHGYILPGLGDAGDKIFGTK