Protein Info for DVU1006 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 60 to 95 (36 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details PF04307: YdjM" amino acids 6 to 146 (141 residues), 43.8 bits, see alignment E=1e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1006)

Predicted SEED Role

"FIG00603845: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DC3 at UniProt or InterPro

Protein Sequence (149 amino acids)

>DVU1006 hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPGYRVHLIAGAVTGAAALTAATQTGLLMADRETQAALFCVTLASSIFPDIDTPSKGRPW
FYGALAAADAFLIYTRRYFWASLLGFMAMLPCIGGHRGWTHTWWAMLLVPLPLLLAPVHL
FGMSWRGAAVWYLAAVLGYASHLVLDEKW