Protein Info for DVU1004 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 51 (18 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details PF00892: EamA" amino acids 1 to 134 (134 residues), 76.2 bits, see alignment E=1.4e-25 amino acids 148 to 277 (130 residues), 71 bits, see alignment E=5.9e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1985)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DC5 at UniProt or InterPro

Protein Sequence (294 amino acids)

>DVU1004 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTGYLLVLLAASLWALIGPLARFCMDEGLSPPEIALWRAAFGALFFALHAWRCGLWRVDP
RHGAAMSAFGIVGVGVLFGSYQYAVQEGGAALAAVLLYTAPAWVAVLSRLLLHEPLTRRK
LAALVVAMTGAVLTCLSGGGLSGGASTAGIVAGLISGFAYSLHYIFSAHWMRRYSPVTLY
LYCLPAGVATLVPFTTFTHKTPTAWLLLVAIGLLTTYCAYFVYCEGIRRLAPTRVAIVAN
LEPVLAALLAYLWWGELFPPLGWLGAGLVLTAVFLIVLDRSETPQVPPHSTKPE