Protein Info for DVU0999 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: thio:disulfide interchange protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 323 to 344 (22 residues), see Phobius details amino acids 373 to 398 (26 residues), see Phobius details amino acids 406 to 430 (25 residues), see Phobius details amino acids 444 to 471 (28 residues), see Phobius details amino acids 477 to 498 (22 residues), see Phobius details amino acids 510 to 533 (24 residues), see Phobius details amino acids 538 to 559 (22 residues), see Phobius details amino acids 571 to 590 (20 residues), see Phobius details amino acids 665 to 686 (22 residues), see Phobius details PF02683: DsbD" amino acids 328 to 533 (206 residues), 55.1 bits, see alignment E=1.5e-18 PF13899: Thioredoxin_7" amino acids 612 to 681 (70 residues), 35.7 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: K04084, thiol:disulfide interchange protein DsbD [EC: 1.8.1.8] (inferred from 100% identity to dvu:DVU0999)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DD0 at UniProt or InterPro

Protein Sequence (719 amino acids)

>DVU0999 thio:disulfide interchange protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRHQTRVSNIAISCVLAAFLLLLPGLVPVLVPWATLDGGALSAHAAEPVTFSTELAHDRE
TAGGIIVLWIDPAPEYHAYAHEPGVDTRPTVVSVHDRSGTPLDLPVLYMPGEPLDDPFTP
GRIVNAYGPKTPVFVKVPALLAGGDVIVRTSLLLCSDRNCQPVRHDIVVTLPGEGAFAAL
PDAASRPWRGKLAQAVPGRPVAGAVAPGMTGTPSAGAVGDGAAIGMGGVTPTPRDAAPGT
GGSLPFPSSTGVDTTATAGNVARGEEEQAQKAVSGIVSVSPEGTSSGVAVSRSVSGAAQE
SPAWSFAPRYFAPELEVSGLGKALLLGLLAGLILNVMPCVLPVISLKLSGFIATSGAPGD
EGVRRRAFREHNLFFAAGILVWFVVLAGILAVAGLAWGQLFQRPGVLFGLTLVVFTLGLS
MFGVFSLPVLDLKAGTTGSPRAQAFMTGVVATLLATPCSGPLLGGVLGWAFRQPSSVLAL
VFAFVGLGMASPYLLMAARPGLVRFFPRPGAWTGVMEQVVGFFLMATSVYLLTILPAALL
LPMLVTLLVAAFAAWLWGTWAGPGASSVQRIAVRCVAVALVGMTVAWALSPPADEARWEP
FEATAFRDMLGRQPVIVDFTADWCPNCKLLERTTLNAANMARWQKAYGARLVRVDLTRDD
PVAQALLHSLGSSSIPVVALFPTGLLRNAPLVLRDLFTADQMDEALERAFGPAGQPLQP