Protein Info for DVU0990 in Desulfovibrio vulgaris Hildenborough JW710

Name: nth
Annotation: endonuclease III, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR01083: endonuclease III" amino acids 8 to 199 (192 residues), 247.6 bits, see alignment E=3.9e-78 PF00730: HhH-GPD" amino acids 38 to 173 (136 residues), 90.2 bits, see alignment E=1.6e-29 PF00633: HHH" amino acids 104 to 131 (28 residues), 28 bits, see alignment (E = 2.1e-10) PF10576: EndIII_4Fe-2S" amino acids 192 to 208 (17 residues), 21.7 bits, see alignment (E = 3e-08)

Best Hits

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 100% identity to dvu:DVU0990)

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DD9 at UniProt or InterPro

Protein Sequence (285 amino acids)

>DVU0990 endonuclease III, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPLPSVQQRALQVLDLLRRRYPTPATHLVARNPWELLVATVLAAQCTDERVNKVTPHLFA
LWPDPAALACATQEALEEVIHSTGFYRNKAKNLLGAARRVTEVHGGEVPRTMDELVQLPG
VARKTANVVLWGGFGVNEGIAVDTHVKRIVHRMGLTKETDPVAVERDLMRLYPREAWGDV
NHMLVWFGRHVCDARKPLCEQCEMAGICAKVGVGKEDAPAAPRKGRKPGAVAAKSGRSGT
RGRKTASTKDAGEDAARAAASAGQAHETGTKPVRGRRGKSGGGDA