Protein Info for DVU0980 in Desulfovibrio vulgaris Hildenborough JW710

Name: b1199
Annotation: DAK2 domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 TIGR02365: dihydroxyacetone kinase, L subunit" amino acids 9 to 205 (197 residues), 268.6 bits, see alignment E=1.6e-84 PF02734: Dak2" amino acids 32 to 205 (174 residues), 181.2 bits, see alignment E=8.7e-58

Best Hits

Swiss-Prot: 55% identical to DHAL_ECOLI: PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL (dhaL) from Escherichia coli (strain K12)

KEGG orthology group: K05879, dihydroxyacetone kinase, C-terminal domain [EC: 2.7.1.-] (inferred from 100% identity to dvl:Dvul_2008)

MetaCyc: 55% identical to dihydroxyacetone kinase subunit L (Escherichia coli K-12 substr. MG1655)
Phosphoenolpyruvate--glycerone phosphotransferase. [EC: 2.7.1.121]

Predicted SEED Role

"Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), ADP-binding subunit DhaL" in subsystem Dihydroxyacetone kinases (EC 2.7.1.121)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.121

Use Curated BLAST to search for 2.7.1.- or 2.7.1.121

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DE9 at UniProt or InterPro

Protein Sequence (210 amino acids)

>DVU0980 DAK2 domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQLTRKHVLTWLARLGDIMRENKAYLTDLDAAIGDADHGINMDRGFGKVQEKLAAFEDKD
IGAILKDTGMVLLSSVGGASGPLYGTFFMKAGLAVAGKDTLDATETLTMLEAGVAGLVSR
GRPVLQDKTMYDAWAPALDAFRAALGKGDDLALALDAAVDAAGEGMRATIPMQARKGRAS
YLGERSIGHQDPGATSTVFMLTALRDVVRG