Protein Info for DVU0979 in Desulfovibrio vulgaris Hildenborough JW710

Name: b1200
Annotation: DAK1 domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR02363: dihydroxyacetone kinase, DhaK subunit" amino acids 1 to 349 (349 residues), 475.6 bits, see alignment E=3.6e-147 PF02733: Dak1" amino acids 17 to 349 (333 residues), 423.8 bits, see alignment E=1.7e-131

Best Hits

Swiss-Prot: 61% identical to DHAK_ECOLI: PEP-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK (dhaK) from Escherichia coli (strain K12)

KEGG orthology group: K05878, dihydroxyacetone kinase, N-terminal domain [EC: 2.7.1.-] (inferred from 100% identity to dvl:Dvul_2009)

MetaCyc: 61% identical to dihydroxyacetone kinase subunit K (Escherichia coli K-12 substr. MG1655)
Phosphoenolpyruvate--glycerone phosphotransferase. [EC: 2.7.1.121]

Predicted SEED Role

"Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), dihydroxyacetone binding subunit DhaK" in subsystem Dihydroxyacetone kinases (EC 2.7.1.121)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.121

Use Curated BLAST to search for 2.7.1.- or 2.7.1.121

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DF0 at UniProt or InterPro

Protein Sequence (354 amino acids)

>DVU0979 DAK1 domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKKLINAVENVVREQLQGMAAAHPELRVNIDPHYICRADIPDGKVAIVSGGGSGHEPMHG
GFVGRGMLDGACPGEVFTSPTPDQMYECAKAVDRGAGVLFIVKNYTGDVMNFETAAELCH
ADGIKVQNILIDDDVAVKDSLYTAGRRGVGTTVLAEKIVGAAAEAGYDLDRCADLCRKVN
RYGRSMGMALTSCTVPAAGKPTFELAEDEIEIGIGIHGEPGTQRAAMMTVDELVEVMATA
IIDDPAYTRTVREFDRAAGDWVEKSLTDEPFAKGDRVIAFVNSMGGTPVSELYAAYRKLA
EICDRRGIVIVRNLIGPYITSLEMQGFSITLLKVDDEMLAFWDAKAVTPGLRMG