Protein Info for DVU0971 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: molybdenum cofactor biosynthesis protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00994: MoCF_biosynth" amino acids 101 to 244 (144 residues), 105.3 bits, see alignment E=1.2e-34 TIGR00177: molybdenum cofactor synthesis domain" amino acids 102 to 239 (138 residues), 102.9 bits, see alignment E=7.9e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0971)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>DVU0971 molybdenum cofactor biosynthesis protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQAHYFDMSVQPVRNGQVLPLAHSALAGVASHAVPRGMVPAVGTVLRSSEGVDLFRIVGH
AMLPACDAPHAVPCALASALTDLSAGPVRCRVTSEGYALAWVTLSDKGAQGQREDASGPC
IAAMVRESIPLRYEQGFMLPDDGAQLRALLTELALVQRYDIIITTGGTGLGPRDVTPEAT
SAVIEKRLQGFEQAMLAASLAKTPHAVISRALAGTLGGAIIINLPGSRKAVAENLEAVLP
ALPHALAKLQGDPSDCAQA