Protein Info for DVU0969 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: efflux protein, LysE family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details PF01810: LysE" amino acids 15 to 245 (231 residues), 131 bits, see alignment E=2e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0969)

Predicted SEED Role

"efflux protein, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DG0 at UniProt or InterPro

Protein Sequence (248 amino acids)

>DVU0969 efflux protein, LysE family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDSDILALAGLAALLTVTPGPDTMLVLRNVLRGGTRGGVSTALGSAAGLLVHLSASALGV
SAVLLHSAEAFATVRLAGACYLLWLGARSLYAALKGPSTPDAAREAHAGGEGLPCCADRG
SASGNGEAPSDALSGEYGTGTAPLVQAWREGFLTNVLNPKVAVFYLAVLPQVAVSAGATV
DTTTALGRSLLFGLFHIIIGVCWFSFLSCSLQRVRTTLLRPMVRRWLDGGVGALMVFFGV
RLATEKGV