Protein Info for DVU0968 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: amino acid ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00005: ABC_tran" amino acids 22 to 170 (149 residues), 134.7 bits, see alignment E=5.2e-43 PF13304: AAA_21" amino acids 126 to 201 (76 residues), 31.1 bits, see alignment E=4.1e-11

Best Hits

Swiss-Prot: 60% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: K10041, putative glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to dvl:Dvul_2020)

MetaCyc: 56% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"amino acid ABC transporter, ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DG1 at UniProt or InterPro

Protein Sequence (246 amino acids)

>DVU0968 amino acid ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTIISARNVNKYFYVPEELHALRDVSLDVAPGEVVVIIGPSGSGKSTFLRCLNRLEYADS
GEILIEGRDILDPKCEINEVRAEVGMVFQSFNLFPHLSVLENVALAQMTVRKRSRAESEK
KGMELLTKVGIADKHAVYPDQLSGGQQQRVAIARSLAMDPKIMLFDEPTSALDPEMVGEV
LDVMRNLAREGMTMVVVTHEMGFAREVADRVVFMDHGAILEIATPKDLFTTGATHDRTKL
FLSQIL