Protein Info for DVU0967 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 126 to 230 (105 residues), 82.9 bits, see alignment E=9.9e-28 PF00528: BPD_transp_1" amino acids 145 to 335 (191 residues), 86.5 bits, see alignment E=9.8e-29

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 100% identity to dvu:DVU0967)

Predicted SEED Role

"amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DG2 at UniProt or InterPro

Protein Sequence (337 amino acids)

>DVU0967 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTQYRGLDKPRGQGYFLFWKAVFVGIMLCTVAFFWYASSSVEYIWRWNRVPQYFWVAEKT
DVRAEVSGDVVSVETTAEGATRITVKGDDGSETYTVPPAGKVLISGGDYIYSGDPVGRYE
VSKPGILLEGLWITLEVSMLAIIIGIVLGVVTGLARISVNPALRWLAITYIEIIRGSPLL
VQVFLWYFVVGTLLNALFEKVGLSAIPPLWYGVMALAIFTGAYVAEIVRAGIQSVHRGQM
EAARSLGMSYAQSMRKVILPQAFRRIMPPLAGQFISLVKDSSLLGVIAVRELTKATREVV
TTSLQPFELWIVCALLYLVLTFTLSLCVQYLERRAVR